IL1RL1 Peptide - C-terminal region
IL1RL1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
T1, St2, DER4, Ly84, ST2L, Fit-1, T1/ST2, St2-rs1
UniProt
P14719
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001020773.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VGDLQDSLQHLVKIQGTIKWREDHVADKQSLSSKFWKHVRYQMPVPERAS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
190914-01 48 Tests
Decorin (DCN) BioAssayTM ELISA Kit (Human) discontinued
Sign In for Pricing
View Details 190914-02 96 Tests
Decorin (DCN) BioAssayTM ELISA Kit (Human) discontinued
Sign In for Pricing
View Details