What is the catalog number for IL1RL1 Peptide - C-terminal region?

The catalog number for IL1RL1 Peptide - C-terminal region is orb1997676.

What sizes are available for IL1RL1 Peptide - C-terminal region?

IL1RL1 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is IL1RL1 Peptide - C-terminal region in stock?

IL1RL1 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

IL1RL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

T1, St2, DER4, Ly84, ST2L, Fit-1, T1/ST2, St2-rs1

UniProt

P14719

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001020773.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VGDLQDSLQHLVKIQGTIKWREDHVADKQSLSSKFWKHVRYQMPVPERAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-12184IR 0.1 mL

Mouse Monoclonal CD9 Antibody (MM0180-5H15) [DyLight 755]

Sign In for Pricing

View Details

OAOA21600-100UG 100 µg

ERG Capture Antibody

Sign In for Pricing

View Details

ELI-51145h 96 Tests

Human Three prime repair exonuclease 1, TREX1 ELISA KIT

Sign In for Pricing

View Details

FM124445-01 0.5 g

N-{[ (4-Methyl-2-oxo-2H-chromen-7-yl) oxy]acetyl}glycine

Sign In for Pricing

View Details

FM124445-02 1 g

N-{[ (4-Methyl-2-oxo-2H-chromen-7-yl) oxy]acetyl}glycine

Sign In for Pricing

View Details

FM124445-03 2 g

N-{[ (4-Methyl-2-oxo-2H-chromen-7-yl) oxy]acetyl}glycine

Sign In for Pricing

View Details