Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LDHB Peptide - middlel region

LDHB Peptide - middlel region

Product Specifications

Product Name Alternative

Ldh2, H-Ldh, LDH-B, LDH-H, Ldh-2, AI790582

UniProt

P16125

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001289694.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P75 NGF Receptor Recombinant Rat Monoclonal Antibody
HA610274 100 µg

P75 NGF Receptor Recombinant Rat Monoclonal Antibody

Sign In for Pricing
View Details
Caper Antibody
8C10192-AAT 50 µg

Caper Antibody

Sign In for Pricing
View Details
Recombinant Human FAM20C/DMP4 Protein (His Tag)
PKSH030502 100 µg

Recombinant Human FAM20C/DMP4 Protein (His Tag)

Sign In for Pricing
View Details
PSMB3 (NM_002795) Human Over-expression Lysate
LY419105 100 µg

PSMB3 (NM_002795) Human Over-expression Lysate

Sign In for Pricing
View Details
Kindlin 2 (FERMT2) (NM_001134999) Human Over-expression Lysate
LY427519 100 µg

Kindlin 2 (FERMT2) (NM_001134999) Human Over-expression Lysate

Sign In for Pricing
View Details
ECHS1 (NM_004092) Human Over-expression Lysate
LY418219 100 µg

ECHS1 (NM_004092) Human Over-expression Lysate

Sign In for Pricing
View Details