LDHB Peptide - middlel region
LDHB Peptide - middlel region
Product Specifications
Product Name Alternative
Ldh2, H-Ldh, LDH-B, LDH-H, Ldh-2, AI790582
UniProt
P16125
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001289694.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882652-500 1x 500 µL
B7-H4 (Immuno-Inhibitory Protein) (B7H4/2652R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP23032PU-N 50 µg
PPAR delta (PPARD) (430-441) Goat Polyclonal Antibody
Sign In for Pricing
View Details