PCDHGC5 Peptide - N-terminal region
PCDHGC5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
PCDH-GAMMA-C5
UniProt
Q9Y5F6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PCDHGC5 Rabbit Polyclonal Antibody (orb580713) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_061752
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IVLDINDNAPTFQSSVLRVGIPENAPIGTLLLRLNATDPDEGTNGQLDYS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472216-100 1x 100 µL
CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940158-500 1x 500 µL
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740630-500 1x 500 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400994-100 1x 100 µL
TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details