Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT2B Peptide - middle region

WNT2B Peptide - middle region

Product Specifications

Product Name Alternative

Wnt13

UniProt

O70283

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033546.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-KDELR3 Rabbit pAb
GB112573-50 50 μL

Anti-KDELR3 Rabbit pAb

Sign In for Pricing
View Details
Aurora C, NT (G11) (Aurora/IPL1/Eg2 Protein 2, Aurora/IPL1-related Kinase 3, Serine/Threonine Protein Kinase 13, Aurora-related Kinase 3, ARK-3, Aurora Kinase C, Serine/Threonine-protein Kinase Aurora-C, AURKC, AIE2, AIK3, ARK3, STK13)
A4190-17G 200 µL

Aurora C, NT (G11) (Aurora/IPL1/Eg2 Protein 2, Aurora/IPL1-related Kinase 3, Serine/Threonine Protein Kinase 13, Aurora-related Kinase 3, ARK-3, Aurora Kinase C, Serine/Threonine-protein Kinase Aurora-C, AURKC, AIE2, AIK3, ARK3, STK13)

Sign In for Pricing
View Details
FOXB1/2 Antibody
E034037 100 µg -100 µL

FOXB1/2 Antibody

Sign In for Pricing
View Details
Duck Dicer 1, Ribonuclease Type III ELISA Kit
MBS095609 Inquire

Duck Dicer 1, Ribonuclease Type III ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O9:H4 (strain HS) LIPA Polyclonal Antibody
MBS7140054 Inquire

Rabbit anti-Escherichia coli O9:H4 (strain HS) LIPA Polyclonal Antibody

Sign In for Pricing
View Details
CdcA7L siRNA (h)
sc-89743 10 µM

CdcA7L siRNA (h)

Sign In for Pricing
View Details