Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT2B Peptide - middle region

WNT2B Peptide - middle region

Product Specifications

Product Name Alternative

Wnt13

UniProt

O70283

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_033546.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDH1B Human shRNA Plasmid Kit (Locus ID 130752)
TR311531 1 Kit

MDH1B Human shRNA Plasmid Kit (Locus ID 130752)

Sign In for Pricing
View Details
Rabbit Polyclonal CLVS2 Antibody [HRP]
NBP2-97429H 0.1 mL

Rabbit Polyclonal CLVS2 Antibody [HRP]

Sign In for Pricing
View Details
PRKAA1 Rabbit Polyclonal Antibody (HRP)
orb2107403 100 µL

PRKAA1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
SIX3 siRNA (Human)
orb1863866-01 15 nmol

SIX3 siRNA (Human)

Sign In for Pricing
View Details
SIX3 siRNA (Human)
orb1863866-02 30 nmol

SIX3 siRNA (Human)

Sign In for Pricing
View Details
CXCL9 Protein Vector (Mouse) (pPM-C-His)
PV169201 500 ng

CXCL9 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details