Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNM1L Peptide - middle region

DNM1L Peptide - middle region

Product Specifications

Product Name Alternative

Dlp1, Drp1, Dnmlp1, python, AI450666, 6330417M19Rik

UniProt

Q8K1M6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001021118.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAX Antibody - N-terminal region : FITC (ARP31926_P050-FITC)
ARP31926_P050-FITC 100 µL

RAX Antibody - N-terminal region : FITC (ARP31926_P050-FITC)

Sign In for Pricing
View Details
LentimiRa-mmu-miR-7211-5p Vector
mm41939 500 ng

LentimiRa-mmu-miR-7211-5p Vector

Sign In for Pricing
View Details
CD80 Recombinant Antibody, APC Conjugated
bsm-61404R-APC-TR 20 µL

CD80 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
APC11 CRISPR/Cas9 KO Plasmid (h)
sc-405947 20 µg

APC11 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
SOX10 Rabbit mAb
RDSA67012 100 µL

SOX10 Rabbit mAb

Sign In for Pricing
View Details
3- (3,5-Dichlorophenyl) aniline Hydrochloride
422704-01 100 mg

3- (3,5-Dichlorophenyl) aniline Hydrochloride

Sign In for Pricing
View Details