DNM1L Peptide - middle region
DNM1L Peptide - middle region
Product Specifications
Product Name Alternative
Dlp1, Drp1, Dnmlp1, python, AI450666, 6330417M19Rik
UniProt
Q8K1M6
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001021118.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1433214-01 0.02 mg (E-Coli)
Recombinant Oryza nivara ATP synthase epsilon chain, chloroplastic (atpE)
Sign In for Pricing
View Details MBS1433214-02 0.1 mg (E-Coli)
Recombinant Oryza nivara ATP synthase epsilon chain, chloroplastic (atpE)
Sign In for Pricing
View Details MBS1433214-03 0.02 mg (Yeast)
Recombinant Oryza nivara ATP synthase epsilon chain, chloroplastic (atpE)
Sign In for Pricing
View Details MBS1433214-04 0.1 mg (Yeast)
Recombinant Oryza nivara ATP synthase epsilon chain, chloroplastic (atpE)
Sign In for Pricing
View Details MBS1433214-05 0.02 mg (Baculovirus)
Recombinant Oryza nivara ATP synthase epsilon chain, chloroplastic (atpE)
Sign In for Pricing
View Details