PGRMC1 Peptide - middle region
PGRMC1 Peptide - middle region
Product Specifications
Product Name Alternative
PPMR, Vema, HPR6.6, AA415812
UniProt
O55022
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_058063.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1131780-01 0.02 mg (E-Coli)
Recombinant Acinetobacter sp. Pca operon regulatory protein (pcaU)
Sign In for Pricing
View Details MBS1131780-02 0.02 mg (Yeast)
Recombinant Acinetobacter sp. Pca operon regulatory protein (pcaU)
Sign In for Pricing
View Details MBS1131780-03 0.1 mg (E-Coli)
Recombinant Acinetobacter sp. Pca operon regulatory protein (pcaU)
Sign In for Pricing
View Details MBS1131780-04 0.1 mg (Yeast)
Recombinant Acinetobacter sp. Pca operon regulatory protein (pcaU)
Sign In for Pricing
View Details MBS1131780-05 0.02 mg (Baculovirus)
Recombinant Acinetobacter sp. Pca operon regulatory protein (pcaU)
Sign In for Pricing
View Details MBS1131780-06 0.02 mg (Mammalian-Cell)
Recombinant Acinetobacter sp. Pca operon regulatory protein (pcaU)
Sign In for Pricing
View Details