What is the catalog number for PGRMC1 Peptide - middle region?

The catalog number for PGRMC1 Peptide - middle region is orb1997587.

What sizes are available for PGRMC1 Peptide - middle region?

PGRMC1 Peptide - middle region is available in the following size(s): 100 µg.

Is PGRMC1 Peptide - middle region in stock?

PGRMC1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PGRMC1 Peptide - middle region

Product Specifications

Product Name Alternative

PPMR, Vema, HPR6.6, AA415812

UniProt

O55022

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_058063.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

V5668-100UG 100 µg

Colipase Antibody / CLPS

Sign In for Pricing

View Details

APG01805G-01 50 µL

ALDOC Antibody (C-term) [APG01805G]

Sign In for Pricing

View Details

APG01805G-02 100 µL

ALDOC Antibody (C-term) [APG01805G]

Sign In for Pricing

View Details

APG01805G-03 200 µL

ALDOC Antibody (C-term) [APG01805G]

Sign In for Pricing

View Details

APG01805G-04 400 µL

ALDOC Antibody (C-term) [APG01805G]

Sign In for Pricing

View Details

MBS8425902-01 1 Kit

Human Soluble Cluster of Differentiation 14 CLIA Kit

Sign In for Pricing

View Details