What is the catalog number for MTF1 Peptide - middle region?

The catalog number for MTF1 Peptide - middle region is orb1997576.

What sizes are available for MTF1 Peptide - middle region?

MTF1 Peptide - middle region is available in the following size(s): 100 µg.

Is MTF1 Peptide - middle region in stock?

MTF1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MTF1 Peptide - middle region

Product Specifications

Product Name Alternative

MTF-1, Thyls

UniProt

Q07243

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032662.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THTGERPFFCPSNGCEKTFSTQYSLKSHMKGHDNKGTAYSALPQHNGSED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb3089768 100 µg

Zebrafish HBAE1.1/HBAE1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing

View Details

REA24833-01 50 mg

7-Bromo-1H,2H,3H-pyrazolo[1,5-a]imidazole

Sign In for Pricing

View Details

REA24833-02 0.5 g

7-Bromo-1H,2H,3H-pyrazolo[1,5-a]imidazole

Sign In for Pricing

View Details

PC1010556-01 250 mg

1- (2,4-difluorophenyl) cycloheptanol

Sign In for Pricing

View Details

PC1010556-02 500 mg

1- (2,4-difluorophenyl) cycloheptanol

Sign In for Pricing

View Details

PC1010556-03 1 g

1- (2,4-difluorophenyl) cycloheptanol

Sign In for Pricing

View Details