What is the catalog number for MTF1 Peptide - middle region?

The catalog number for MTF1 Peptide - middle region is orb1997576.

What sizes are available for MTF1 Peptide - middle region?

MTF1 Peptide - middle region is available in the following size(s): 100 µg.

Is MTF1 Peptide - middle region in stock?

MTF1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MTF1 Peptide - middle region

Product Specifications

Product Name Alternative

MTF-1, Thyls

UniProt

Q07243

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_032662.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THTGERPFFCPSNGCEKTFSTQYSLKSHMKGHDNKGTAYSALPQHNGSED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PVT31876 2 µg

pEnCMV-SKP1-3XHA Plasmid

Sign In for Pricing

View Details

orb2928061-01 20 µg

Recombinant Escherichia coli Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Sign In for Pricing

View Details

orb2928061-02 100 µg

Recombinant Escherichia coli Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Sign In for Pricing

View Details

A18646-100 100 mg

Biotin sulfone 100mg

Sign In for Pricing

View Details

sc-409253-NIC-2 20 µg

claudin-17 Double Nickase Plasmid (h2)

Sign In for Pricing

View Details

A12946-200 200 mg

Eliprodil 200mg

Sign In for Pricing

View Details