Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX27 Peptide - middle region

SNX27 Peptide - middle region

Product Specifications

Product Name Alternative

ESTM45, ESTM47, R75405, 5730552M22Rik

UniProt

Q3UHD6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001075953.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFYDYTEKQAVPISV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ogfrl1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3673003 1.0 µg DNA

Ogfrl1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
MTMR14 Rabbit Polyclonal Antibody
TA378757 100 µL

MTMR14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
[Val5] Angiotensin II, human
orb2693812-01 5 mg

[Val5] Angiotensin II, human

Sign In for Pricing
View Details
[Val5] Angiotensin II, human
orb2693812-02 10 mg

[Val5] Angiotensin II, human

Sign In for Pricing
View Details
Randaiol
HY-N1531 1 Each

Randaiol

Sign In for Pricing
View Details
Nr5a2 ORF Vector (Mouse) (pORF)
ORF051648 1.0 µg DNA

Nr5a2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details