PFAS Peptide - C-terminal region
PFAS Peptide - C-terminal region
Product Specifications
Product Name Alternative
Gm18, PURL, Sofa, FGAMS, FGARAT, FGAR-AT, 4432409B16Rik
UniProt
Q5SUR0
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001152991.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HGEGYMAFSSPELQAKIEAKGLVPLHWADDDGNPTEQYPLNPNGSPGGIA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15095645 1 Vial
Lentiviral human DNAJC16 shRNA (UAS) - Lentiviral human DNAJC16 shRNA (UAS) (25)
Sign In for Pricing
View Details 
302456-ML550 100 µL
FXC1 (Mitochondrial import inner Membrane Translocase Subunit Tim10 B, Fracture callus Protein 1, FxC1, Mitochondrial import inner Membrane Translocase Subunit Tim9 B, TIMM10B, Tim10b, TIMM10B, FXC1, TIM9B, TIMM9B) (MaxLight 550) discontinued
Sign In for Pricing
View Details