Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PFAS Peptide - C-terminal region

PFAS Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gm18, PURL, Sofa, FGAMS, FGARAT, FGAR-AT, 4432409B16Rik

UniProt

Q5SUR0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001152991.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HGEGYMAFSSPELQAKIEAKGLVPLHWADDDGNPTEQYPLNPNGSPGGIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Transcobalamin II Antibody (049) [DyLight 488]
NBP2-89597G 0.1 mL

Rabbit Monoclonal Transcobalamin II Antibody (049) [DyLight 488]

Sign In for Pricing
View Details
Horse Angiopoietin 1 (ANG-1) ELISA Kit
MBS2803038-01 48 Tests

Horse Angiopoietin 1 (ANG-1) ELISA Kit

Sign In for Pricing
View Details
Horse Angiopoietin 1 (ANG-1) ELISA Kit
MBS2803038-02 96 Tests

Horse Angiopoietin 1 (ANG-1) ELISA Kit

Sign In for Pricing
View Details
Horse Angiopoietin 1 (ANG-1) ELISA Kit
MBS2803038-03 5x 96 Tests

Horse Angiopoietin 1 (ANG-1) ELISA Kit

Sign In for Pricing
View Details
Horse Angiopoietin 1 (ANG-1) ELISA Kit
MBS2803038-04 10x 96 Tests

Horse Angiopoietin 1 (ANG-1) ELISA Kit

Sign In for Pricing
View Details
HSP90 beta Recombinant Rabbit mAb, PerCP-Cy7 conjugated
orb3000167 100 µL

HSP90 beta Recombinant Rabbit mAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details