Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATM Peptide - middle region

GATM Peptide - middle region

Product Specifications

Product Name Alternative

AT, AI314789, 1810003P21Rik

UniProt

Q9D964

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_080237.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Liver
CS505692 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
p47-phox Mouse Monoclonal Antibody [A6B10]
HA600050 100 µL

p47-phox Mouse Monoclonal Antibody [A6B10]

Sign In for Pricing
View Details
Annexin A2 (ANXA2) (NM_001002857) Human Over-expression Lysate
LC400369 20 µg

Annexin A2 (ANXA2) (NM_001002857) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IFN-alpha/beta R1, C-His (ECD)
HA210626-01 20 µg

Human IFN-alpha/beta R1, C-His (ECD)

Sign In for Pricing
View Details
Human IFN-alpha/beta R1, C-His (ECD)
HA210626-02 50 µg

Human IFN-alpha/beta R1, C-His (ECD)

Sign In for Pricing
View Details
Human IFN-alpha/beta R1, C-His (ECD)
HA210626-03 100 µg

Human IFN-alpha/beta R1, C-His (ECD)

Sign In for Pricing
View Details