Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GATM Peptide - middle region

GATM Peptide - middle region

Product Specifications

Product Name Alternative

AT, AI314789, 1810003P21Rik

UniProt

Q9D964

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_080237.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG72 Mouse Monoclonal Antibody [Clone ID: B72.3 + CC49]
AM33342PU-S 100 µg

TAG72 Mouse Monoclonal Antibody [Clone ID: B72.3 + CC49]

Sign In for Pricing
View Details
CPSF4L Human Gene Knockout Kit (CRISPR)
KN425192 1 Kit

CPSF4L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS705461 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Isoacetovanillone-d3
TRC-I780002-10MG 10 mg

Isoacetovanillone-d3

Sign In for Pricing
View Details
TIMP1 (NM_003254) Human Recombinant Protein
TP723878 10 µg

TIMP1 (NM_003254) Human Recombinant Protein

Sign In for Pricing
View Details
Human COX5A, C-His Tag
HA210534-01 20 µg

Human COX5A, C-His Tag

Sign In for Pricing
View Details