Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INVS Peptide - C-terminal region

INVS Peptide - C-terminal region

Product Specifications

Product Name Alternative

INV, NPH2, NPHP2

UniProt

Q9Y283

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INVS Rabbit Polyclonal Antibody (orb635623) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055240

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALLKAGADVNKTDHSQRTALHLAAQKGNYRFMKLLLTRRANWMQKDLEEM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C21orf63 3'UTR Luciferase Stable Cell Line
TU003266 1.0 mL

C21orf63 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Tetra Butyl Ammonium Bromide 99.0%
238475-01 25 Kg

Tetra Butyl Ammonium Bromide 99.0%

Sign In for Pricing
View Details
Tetra Butyl Ammonium Bromide 99.0%
238475-02 500 g

Tetra Butyl Ammonium Bromide 99.0%

Sign In for Pricing
View Details
Tetra Butyl Ammonium Bromide 99.0%
238475-03 1 kg

Tetra Butyl Ammonium Bromide 99.0%

Sign In for Pricing
View Details
Anti-NDEL1 Antibody Picoband® Fluoro488 Conjugated
A02478-2-Fluoro488 100 µg/Vial

Anti-NDEL1 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
CD28 (Biotin)
C2380-03B 100 µg

CD28 (Biotin)

Sign In for Pricing
View Details