Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Complement factor I (Cfi)

Product Specifications

Product Name Alternative

C3B/C4B inactivator

Abbreviation

Recombinant Mouse Cfi protein

Gene Name

Cfi

UniProt

Q61129

Expression Region

19-603aa

Organism

Mus musculus (Mouse)

Target Sequence

RSPSASDLPQEELVDQKCLLQKYTHRSCNKVFCQPWQRCIEGTCICKLPYQCPRAGTPVCAMNGRSYPTYCHQKSFECLHPEIKFSHNGTCAAEGKFNVSLIYGRTKTEGLVQVKLVDQDERMFICKNSWSMAEANVACVDLGFPLGVRDIQGSFNISGNLHINDTECLHVHCRGVETSLAECAFTKRRTELSNGLAGVVCYKQDADFPTSLSFQCVNGKHIPQEKACNGVNDCGDQSDELCCKGCRGNASLCKSGVCIPDQYKCNGEVDCITGEDESRCEEDRQQNIPKGLARSAQGEAEIETEETEMLTPGMDNERKRIKSLLPKLSCGVKRNTHTRRKRVIGGKPANVGDYPWQVAIKDGQRITCGGIYIGGCWILTAAHCVRPSRAHSYQVWTALLDWLKPNSQLGIQTVKRVIVHEKYNGATFQNDIALIEMKMHTGKKECELPNSVPACVPWSPYLFQPNDRCIISGWGRGKDNQKVYSLRWGEVDLIGNCSQFYPDRYYEKEMQCAGTRDGSIDACKGDSGGPLVCEDINNVTYVWGIVSWGENCGKPEFPGVYTRVANYFDWISYHVGRSLVSQHNV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Trypsin-like serine protease that plays an essential role in regulating the immune response by controlling all complement pathways.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

69.8 kDa

References & Citations

"cDNA cloning, sequencing and chromosomal assignment of the gene for mouse complement factor I (C3b/C4b inactivator) : identification of a species specific divergent segment in factor I." Minta J.O., Wong M.J., Kozak C.A., Kunnath-Muglia L.M., Goldberger G. Mol. Immunol. 33:101-112 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RITA (RITA1) (NM_032848) Human Over-expression Lysate
LY409884 100 µg

RITA (RITA1) (NM_032848) Human Over-expression Lysate

Sign In for Pricing
View Details
Eucommiae Cortex Extract
E3173-25mg 25 mg

Eucommiae Cortex Extract

Sign In for Pricing
View Details
HLA-DPB2 Human qPCR Primer Pair (NR_001435)
HP219898 200 Reactions

HLA-DPB2 Human qPCR Primer Pair (NR_001435)

Sign In for Pricing
View Details
Human macrophage inflammatory protein 2,MIP-2 ELISA Kit
CN-03295H1 96T

Human macrophage inflammatory protein 2,MIP-2 ELISA Kit

Sign In for Pricing
View Details
Fibp Mouse Gene Knockout Kit (CRISPR)
KN505969 1 Kit

Fibp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Aatf sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3937307 1.0 µg DNA

Aatf sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details