Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Androgen receptor (AR), partial

This Recombinant Human Androgen receptor (AR), partial spans the amino acid sequence from region 559-671aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)

UniProt

P10275

Expression Region

559-671aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCY2 Knockout HAP1 Polyclonal Cells
ARG21660 1 Million

ADCY2 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
Trim60 ORF Vector (Mouse) (pORF)
ORF060411 1.0 µg DNA

Trim60 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Anti Multi-Species CD44 Flow Cytometry Monoclonal Clone IM7 APC 25ug
IRTAMLCD44IM7CAPC25UG 25 µg

Anti Multi-Species CD44 Flow Cytometry Monoclonal Clone IM7 APC 25ug

Sign In for Pricing
View Details
GPX3 Antibody
orb789909 2 mg

GPX3 Antibody

Sign In for Pricing
View Details
DTNB Polyclonal Antibody
MBS2526741-01 0.02 mL

DTNB Polyclonal Antibody

Sign In for Pricing
View Details
DTNB Polyclonal Antibody
MBS2526741-02 0.06 mL

DTNB Polyclonal Antibody

Sign In for Pricing
View Details