Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Androgen receptor (AR), partial

This Recombinant Human Androgen receptor (AR), partial spans the amino acid sequence from region 559-671aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Dihydrotestosterone receptor) (Nuclear receptor subfamily 3 group C member 4)

UniProt

P10275

Expression Region

559-671aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PRMT6 Antibody (R3Z05)
RHK48101 100 μg

Anti-PRMT6 Antibody (R3Z05)

Sign In for Pricing
View Details
3- ([ (4-Bromophenyl) sulfanyl]methyl) benzoic acid
OR1002939-01 250 mg

3- ([ (4-Bromophenyl) sulfanyl]methyl) benzoic acid

Sign In for Pricing
View Details
3- ([ (4-Bromophenyl) sulfanyl]methyl) benzoic acid
OR1002939-02 500 mg

3- ([ (4-Bromophenyl) sulfanyl]methyl) benzoic acid

Sign In for Pricing
View Details
3- ([ (4-Bromophenyl) sulfanyl]methyl) benzoic acid
OR1002939-03 1 g

3- ([ (4-Bromophenyl) sulfanyl]methyl) benzoic acid

Sign In for Pricing
View Details
3- ([ (4-Bromophenyl) sulfanyl]methyl) benzoic acid
OR1002939-04 2.5 g

3- ([ (4-Bromophenyl) sulfanyl]methyl) benzoic acid

Sign In for Pricing
View Details
BATF2 293 Cell Lysate
404706 0.1 mg

BATF2 293 Cell Lysate

Sign In for Pricing
View Details