Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stabilin-1 (STAB1), partial

This Recombinant Human Stabilin-1 (STAB1), partial spans the amino acid sequence from region 2319-2462aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavenger receptor 1) (FEEL-1) (MS-1 antigen)

UniProt

Q9NY15

Expression Region

2319-2462aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STCNGKLLDVLAATANFSTFYGMLLGYANATQRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATLLSANASQGKLLPAHSGLSLIISDAGPDNSSWAPVAPGTVVVSRIIVWDIMAFNGIIHALASPLLAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant EBOV (subtype Zaire, strain Mayinga 1976) Glycoprotein / GP-RBD Protein (Fc Tag)
PKSV030164 100 µg

Recombinant EBOV (subtype Zaire, strain Mayinga 1976) Glycoprotein / GP-RBD Protein (Fc Tag)

Sign In for Pricing
View Details
Human NKX1-2 activation kit by CRISPRa
GA118093 1 Kit

Human NKX1-2 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Aktip activation kit by CRISPRa
GA201484 1 Kit

Mouse Aktip activation kit by CRISPRa

Sign In for Pricing
View Details
Resorufin Benzyl Ether
TRC-R146518-25MG 25 mg

Resorufin Benzyl Ether

Sign In for Pricing
View Details
Biotin Conjugated Goat Affinity Purified Antibody to Mouse IgG + IgM (min.x Hu., Bov., Eq.),
BAF-444-1 1 mL

Biotin Conjugated Goat Affinity Purified Antibody to Mouse IgG + IgM (min.x Hu., Bov., Eq.),

Sign In for Pricing
View Details
Hcn4 Mouse Monoclonal Antibody [Clone ID: N114/10]
75-150 100 µL

Hcn4 Mouse Monoclonal Antibody [Clone ID: N114/10]

Sign In for Pricing
View Details