Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stabilin-1 (STAB1), partial

This Recombinant Human Stabilin-1 (STAB1), partial spans the amino acid sequence from region 2319-2462aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavenger receptor 1) (FEEL-1) (MS-1 antigen)

UniProt

Q9NY15

Expression Region

2319-2462aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STCNGKLLDVLAATANFSTFYGMLLGYANATQRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATLLSANASQGKLLPAHSGLSLIISDAGPDNSSWAPVAPGTVVVSRIIVWDIMAFNGIIHALASPLLAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ADORA2A Protein, Flag, His Tag (Detergent)
ADA-H52D3-500ug 500 µg

Human ADORA2A Protein, Flag, His Tag (Detergent)

Sign In for Pricing
View Details
Human ZNF80 qPCR Primer Pair
QH25101S 200 Tests

Human ZNF80 qPCR Primer Pair

Sign In for Pricing
View Details
EXOC3 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV662255 1.0 µg DNA

EXOC3 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Islet 1 (ISL1) Mouse Monoclonal Antibody [Clone ID: LBI6E8]
AMM17861VCF 100 µg

Islet 1 (ISL1) Mouse Monoclonal Antibody [Clone ID: LBI6E8]

Sign In for Pricing
View Details
Rat Monoclonal ALCAM/CD166 Antibody (200622) [PE]
FAB11721P 0.1 mL

Rat Monoclonal ALCAM/CD166 Antibody (200622) [PE]

Sign In for Pricing
View Details
Islr2 (NM_001161536) Mouse Tagged Lenti ORF Clone
MR224397L3 10 µg

Islr2 (NM_001161536) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details