Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Unconventional myosin-X (MYO10), partial

This Recombinant Human Unconventional myosin-X (MYO10), partial spans the amino acid sequence from region 1669-1917aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Unconventional myosin-10)

UniProt

Q9HD67

Expression Region

1669-1917aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALFTYESLKKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDNVPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAIPPLEEVYSLQRLKARISQSTKTFTPCERLEKRRTSFLEGTLRRSFRTGSVVRQKVEEEQMLDMWIKEEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Roxindole
HY-106100 1 Each

Roxindole

Sign In for Pricing
View Details
anti-IL10RB
YF-PA12707 100 ul

anti-IL10RB

Sign In for Pricing
View Details
Sheep Anti Mouse Igg (H/L) Polyclonal Antibody,HRP
CPBT-68107SM 1 mg

Sheep Anti Mouse Igg (H/L) Polyclonal Antibody,HRP

Sign In for Pricing
View Details
MRPS27 (28S Ribosomal Protein S27, Mitochondrial, MRP-S27, S27mt, KIAA0264, FLJ21764, FLJ23348) (MaxLight 490)
129885-ML490 100 µL

MRPS27 (28S Ribosomal Protein S27, Mitochondrial, MRP-S27, S27mt, KIAA0264, FLJ21764, FLJ23348) (MaxLight 490)

Sign In for Pricing
View Details
Nuclear factor NF-kappa-B p105 subunit 1
326398-01 50 µg

Nuclear factor NF-kappa-B p105 subunit 1

Sign In for Pricing
View Details
Nuclear factor NF-kappa-B p105 subunit 1
326398-02 100 µg

Nuclear factor NF-kappa-B p105 subunit 1

Sign In for Pricing
View Details