Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Camelpox virus Protein OPG161 (CMP150R), partial

This Recombinant Camelpox virus Protein OPG161 (CMP150R), partial spans the amino acid sequence from region 58-184aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q775P5

Expression Region

58-184aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Camelpox virus (strain CMS)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RLNQCMSANEAVITDATAVAVASSTHRKVASSTTQYKHKESCNGLYYQGSCYIFHSDYQLFSDAKANCTTESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UBE2W activation kit by CRISPRa
GA110672 1 Kit

Human UBE2W activation kit by CRISPRa

Sign In for Pricing
View Details
SRY Rabbit Polyclonal Antibody
AP06716PU-N 100 µg

SRY Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ferritin Light Chain Antibody
KC-6018-01 50 μL

Ferritin Light Chain Antibody

Sign In for Pricing
View Details
Ferritin Light Chain Antibody
KC-6018-02 100 µL

Ferritin Light Chain Antibody

Sign In for Pricing
View Details
Ferritin Light Chain Antibody
KC-6018-03 1 mL

Ferritin Light Chain Antibody

Sign In for Pricing
View Details
Rpl35 (NM_025592) Mouse Tagged ORF Clone
MG200626 10 µg

Rpl35 (NM_025592) Mouse Tagged ORF Clone

Sign In for Pricing
View Details