Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Camelpox virus Protein OPG161 (CMP150R), partial

This Recombinant Camelpox virus Protein OPG161 (CMP150R), partial spans the amino acid sequence from region 58-184aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q775P5

Expression Region

58-184aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Camelpox virus (strain CMS)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RLNQCMSANEAVITDATAVAVASSTHRKVASSTTQYKHKESCNGLYYQGSCYIFHSDYQLFSDAKANCTTESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BID (NM_001196) Human Over-expression Lysate
LY420074 100 µg

BID (NM_001196) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS802358 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Frozen Tissue Sections, Neurovascular bundle
CS643450 5x 5 µm

Frozen Tissue Sections, Neurovascular bundle

Sign In for Pricing
View Details
1,3-Diisopropylurea
TRC-D459850-50MG 50 mg

1,3-Diisopropylurea

Sign In for Pricing
View Details
CF®700 Succinimidyl Ester
#96067 1x 1 µmol

CF®700 Succinimidyl Ester

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2980R), CF594 conjugate, 0.1mg/mL
BNC942980-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2980R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details