Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dipeptidase 3 (DPEP3), partial (Active)

This Recombinant Human Dipeptidase 3 (DPEP3), partial (Active) spans the amino acid sequence from region 36-463aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UNQ834; PRO1772

UniProt

Q9H4B8

Expression Region

36-463aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human DPEP3 at 2 μg/mL can bind Anti-DPEP3 recombinant antibody. The EC50 is 6.841-7.498 ng/mL.

Form

Lyophilized powder

Molecular Weight

48.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

AETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FR 901379
F047-1MG 1 mg

FR 901379

Sign In for Pricing
View Details
LMO7 (LIM Domain only Protein 7, LMO-7, F-box only Protein 20, LOMP, LMO7, FBX20, FBXO20, KIAA0858) (MaxLight 490) discontinued
302533-ML490 100 µL

LMO7 (LIM Domain only Protein 7, LMO-7, F-box only Protein 20, LOMP, LMO7, FBX20, FBXO20, KIAA0858) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Gonadotropin-releasing Hormone, NT (GnRH, GRH, Gonadotrophin Releasing Hormone 1, GNRH1, GnRH-I, Gonadoliberin I, Gonadoliberin-1, Gonadorelin, Luliberin I, Luteinizing Hormorne Releasing Hormone, LHRH, LH-RH I, LNRH, Luteinizing Releasing Hormone, Progonadoliberin-1 Precursor, Progonadoliberin I, Prolactin Release Inhibiting Factor) (MaxLight 490) discontinued
G8574-95E-ML490 100 µL

Gonadotropin-releasing Hormone, NT (GnRH, GRH, Gonadotrophin Releasing Hormone 1, GNRH1, GnRH-I, Gonadoliberin I, Gonadoliberin-1, Gonadorelin, Luliberin I, Luteinizing Hormorne Releasing Hormone, LHRH, LH-RH I, LNRH, Luteinizing Releasing Hormone, Progonadoliberin-1 Precursor, Progonadoliberin I, Prolactin Release Inhibiting Factor) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Docosane-1,22-diol
M37495-01 1 g

Docosane-1,22-diol

Sign In for Pricing
View Details
Docosane-1,22-diol
M37495-02 200 mg

Docosane-1,22-diol

Sign In for Pricing
View Details
Docosane-1,22-diol
M37495-03 25 mg

Docosane-1,22-diol

Sign In for Pricing
View Details