Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4 (NDUFA4), partial

This Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4 (NDUFA4), partial spans the amino acid sequence from region 38-81aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Complex I-MLRQ; CI-MLRQ; NADH-ubiquinone oxidoreductase MLRQ subunit

UniProt

O00483

Expression Region

38-81aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL
BNC470745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL
BNC400965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-100 1x 100 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-500 1x 500 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc (9E10.3), CF640R conjugate, 0.1mg/mL
BNC400596-100 1x 100 µL

C-Myc (9E10.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details