Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Interleukin 6 receptor (IL6R), partial

This Recombinant Rabbit Interleukin 6 receptor (IL6R), partial spans the amino acid sequence from region 76-385aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

G1TBG5

Expression Region

76-385aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LAPGGCPVLEVASNVVSSQPGASVTLTCPGEELADNANVQWTLGGPPETSRHGLWAGVGRRLLLRSVQLGDSGNYSCYLNGYPVGSVCLLVDVPPEEPRLSCFRRSLISPVTCEWRPQRPPSPTTKAVLVVKKFLNGPANDFQKPCQYSHHSQKFSCQLAIPETDRSSHIVSLCVANTVGSKSSRWEVFDGYEILQPDPPANITVTAMVGKPRWLHVTWQDPSSWNSYFYRLRFELRYRAEQSQDFTAWMVEGRSHRVTRLGAQGLQHHSIIHDAWKGVRHVVQLRAQEEFGHGSWSTWSAEVLGTPWTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ractopamine (Rac1) Antibody
252631 0.1 mL

Ractopamine (Rac1) Antibody

Sign In for Pricing
View Details
Carcinoembryonic Antigen-Related Cell Adhesion Molecule 5 (CEACAM5) Antibody
abx421420-01 50 µg

Carcinoembryonic Antigen-Related Cell Adhesion Molecule 5 (CEACAM5) Antibody

Sign In for Pricing
View Details
Carcinoembryonic Antigen-Related Cell Adhesion Molecule 5 (CEACAM5) Antibody
abx421420-02 100 µg

Carcinoembryonic Antigen-Related Cell Adhesion Molecule 5 (CEACAM5) Antibody

Sign In for Pricing
View Details
MT1E ELISA Kit (Human)
OKEH00346-96W 96 Well

MT1E ELISA Kit (Human)

Sign In for Pricing
View Details
BCL10 Mouse Monoclonal Antibody [Clone ID: OTI2B12]
TA800447 100 µL

BCL10 Mouse Monoclonal Antibody [Clone ID: OTI2B12]

Sign In for Pricing
View Details
3-Iodo-7-methyl-1H-pyrrolo[3,2-c]pyridine
OR1058090-01 100 mg

3-Iodo-7-methyl-1H-pyrrolo[3,2-c]pyridine

Sign In for Pricing
View Details