Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Interleukin 6 receptor (IL6R), partial

This Recombinant Rabbit Interleukin 6 receptor (IL6R), partial spans the amino acid sequence from region 76-385aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

G1TBG5

Expression Region

76-385aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LAPGGCPVLEVASNVVSSQPGASVTLTCPGEELADNANVQWTLGGPPETSRHGLWAGVGRRLLLRSVQLGDSGNYSCYLNGYPVGSVCLLVDVPPEEPRLSCFRRSLISPVTCEWRPQRPPSPTTKAVLVVKKFLNGPANDFQKPCQYSHHSQKFSCQLAIPETDRSSHIVSLCVANTVGSKSSRWEVFDGYEILQPDPPANITVTAMVGKPRWLHVTWQDPSSWNSYFYRLRFELRYRAEQSQDFTAWMVEGRSHRVTRLGAQGLQHHSIIHDAWKGVRHVVQLRAQEEFGHGSWSTWSAEVLGTPWTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Alanine Glyoxylate Aminotransferase 2 (AGXT2) ELISA Kit
YP-W101654-01 48 Tests

Human Alanine Glyoxylate Aminotransferase 2 (AGXT2) ELISA Kit

Sign In for Pricing
View Details
Human Alanine Glyoxylate Aminotransferase 2 (AGXT2) ELISA Kit
YP-W101654-02 96 Tests

Human Alanine Glyoxylate Aminotransferase 2 (AGXT2) ELISA Kit

Sign In for Pricing
View Details
TSC1, Phosphorylated (Y297) (Tsc1, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 490)
MBS6359194-01 0.1 mL

TSC1, Phosphorylated (Y297) (Tsc1, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 490)

Sign In for Pricing
View Details
TSC1, Phosphorylated (Y297) (Tsc1, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 490)
MBS6359194-02 5x 0.1 mL

TSC1, Phosphorylated (Y297) (Tsc1, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 490)

Sign In for Pricing
View Details
H2BC3 (NM_021062) Human Recombinant Protein
TP320710 20 µg

H2BC3 (NM_021062) Human Recombinant Protein

Sign In for Pricing
View Details
PDE8B, ID (PDE8B, High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B, Cell proliferation-inducing gene 22 protein) (Biotin) discontinued
039813-Biotin 200 µL

PDE8B, ID (PDE8B, High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B, Cell proliferation-inducing gene 22 protein) (Biotin) discontinued

Sign In for Pricing
View Details