Recombinant Mouse Regenerating islet-derived protein 3-beta (Reg3b)
This Recombinant Mouse Regenerating islet-derived protein 3-beta (Reg3b) spans the amino acid sequence from region 38-175aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
REG-3-beta; Pancreatitis-associated protein 1; Regenerating islet-derived protein III-beta; Reg III-beta
UniProt
P35230
Expression Region
38-175aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
28.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
ISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDVMNYFNWERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFTG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
031553-ML650 100 µL
ACR, CT (ACR, ACRS, Acrosin, Acrosin light chain, Acrosin heavy chain) (MaxLight 650) discontinued
Sign In for Pricing
View Details 
VAng-Lsx09317-500gEcoli 500 µg (E. coli)
Recombinant Shigella Boydii rimO Protein (aa 1-441)
Sign In for Pricing
View Details orb2369347 100 µL
Histone H3 (di methyl K79) Mouse Monoclonal Antibody (PerCP-Cy5.5)
Sign In for Pricing
View Details 