Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial

This Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial spans the amino acid sequence from region 24-232aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)

UniProt

P24394

Expression Region

24-232aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OPHN1 (NM_002547) Human Over-expression Lysate
LC419253 20 µg

OPHN1 (NM_002547) Human Over-expression Lysate

Sign In for Pricing
View Details
CTDSP1 Goat Polyclonal Antibody
AP31837PU-N 100 µg

CTDSP1 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Apip Mouse Gene Knockout Kit (CRISPR)
KN501398 1 Kit

Apip Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Sts1 (UBASH3B) activation kit by CRISPRa
GA113801 1 Kit

Human Sts1 (UBASH3B) activation kit by CRISPRa

Sign In for Pricing
View Details
Apc5 (ANAPC5) (NM_016237) Human Over-expression Lysate
LY402524 100 µg

Apc5 (ANAPC5) (NM_016237) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS521422 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details