Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial

This Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial spans the amino acid sequence from region 24-232aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)

UniProt

P24394

Expression Region

24-232aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fus 3'UTR Luciferase Stable Cell Line
TU106782 1.0 mL

Fus 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Collagen VI (COL6A2) (NM_001849) Human Tagged ORF Clone
RC209476 10 µg

Collagen VI (COL6A2) (NM_001849) Human Tagged ORF Clone

Sign In for Pricing
View Details
Sheep Survival Of Motor Neuron 1 (SMN1) ELISA kit
GTR10377295 96 Well

Sheep Survival Of Motor Neuron 1 (SMN1) ELISA kit

Sign In for Pricing
View Details
Thiobacillus Broth
M789-500G 500 g

Thiobacillus Broth

Sign In for Pricing
View Details
Recombinant Human Integrin alpha-2 (ITGA2), partial
orb1649712-01 20 µg

Recombinant Human Integrin alpha-2 (ITGA2), partial

Sign In for Pricing
View Details
Recombinant Human Integrin alpha-2 (ITGA2), partial
orb1649712-02 100 µg

Recombinant Human Integrin alpha-2 (ITGA2), partial

Sign In for Pricing
View Details