Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribonuclease K6 (RNASE6)

This Recombinant Human Ribonuclease K6 (RNASE6) spans the amino acid sequence from region 24-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(RNase K6)

UniProt

Q93091

Expression Region

24-150aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

100X Maxi GeBAflex-tube, 50 kDa MWCO, 2 mL cap displace, Floating rack, Handbook
D060-50-100 Each

100X Maxi GeBAflex-tube, 50 kDa MWCO, 2 mL cap displace, Floating rack, Handbook

Sign In for Pricing
View Details
HMCN1 (Hemicentin 1, ARMD1, AXPC1, FBLN6, FIBL6, Fibulin 6, Age Related Macular Degeneration 1 (Senile Macular Degeneration) ) discontinued
363471 200 µL

HMCN1 (Hemicentin 1, ARMD1, AXPC1, FBLN6, FIBL6, Fibulin 6, Age Related Macular Degeneration 1 (Senile Macular Degeneration) ) discontinued

Sign In for Pricing
View Details
Feline Leukemia Virus p27 antibody (HRP)
60-5006 1 mL

Feline Leukemia Virus p27 antibody (HRP)

Sign In for Pricing
View Details
Pilocarpine
C03739-5mg 5 mg

Pilocarpine

Sign In for Pricing
View Details
9-Aminononanoic acid
orb3028718-01 10 mg

9-Aminononanoic acid

Sign In for Pricing
View Details
9-Aminononanoic acid
orb3028718-02 50 mg

9-Aminononanoic acid

Sign In for Pricing
View Details