Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda constant 1 (IGLC1)

This Recombinant Human Immunoglobulin lambda constant 1 (IGLC1) spans the amino acid sequence from region 1-106aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Ig lambda chain C region MGC) (Ig lambda-1 chain C region)

UniProt

P0CG04

Expression Region

1-106aa

Tag

N-terminal 10xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNAB2 Recombinant Protein (Human)
RP040222 100 µg

KCNAB2 Recombinant Protein (Human)

Sign In for Pricing
View Details
Olfr616 Protein Vector (Mouse) (pPB-C-His)
PV211098 500 ng

Olfr616 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Nucleoside Phosphorylase
N7100-69K 1 mg

Nucleoside Phosphorylase

Sign In for Pricing
View Details
CF®543-Cholera Toxin Subunit B (CTB)
CHM-421-100ug 100 µg

CF®543-Cholera Toxin Subunit B (CTB)

Sign In for Pricing
View Details
CHD1 Rabbit Polyclonal Antibody (Fluoro488)
orb3115114 100 µg

CHD1 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
ZC3H13
405639-01 50 µL

ZC3H13

Sign In for Pricing
View Details