Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda constant 1 (IGLC1)

This Recombinant Human Immunoglobulin lambda constant 1 (IGLC1) spans the amino acid sequence from region 1-106aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Ig lambda chain C region MGC) (Ig lambda-1 chain C region)

UniProt

P0CG04

Expression Region

1-106aa

Tag

N-terminal 10xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse LNPEP Protein, His (Fc)-Avi-tagged
LNPEP-5123M 50 µg

Recombinant Mouse LNPEP Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Anti-equine IgG mAb (MT329A4), unconjugated
3153-3-250 250 µg

Anti-equine IgG mAb (MT329A4), unconjugated

Sign In for Pricing
View Details
RNF24 293 Cell Lysate
407540 0.1 mg

RNF24 293 Cell Lysate

Sign In for Pricing
View Details
C8orf45 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-15293R-BF488 100 µL

C8orf45 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
(24R) -24,25-Dihydroxyvitamin D3
GV6226-1mg 1 mg

(24R) -24,25-Dihydroxyvitamin D3

Sign In for Pricing
View Details
Ccdc90b ORF Vector (Mouse) (pORF)
15329014 1.0 µg DNA

Ccdc90b ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details