Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pneumoniae serotype 4 ribosomal protein S12 (rpsL)

This Recombinant Streptococcus pneumoniae serotype 4 ribosomal protein S12 (rpsL) spans the amino acid sequence from region 1-137aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P0A4A7

Expression Region

1-137aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPTINQLVRKPRKSKVEKSKSPALNVGYNSHKKVQTNVSSPQKRGVATRVGTMTPKKPNSALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQGRSKYGTKRPKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYO1D Protein Vector (Human) (pPB-N-His)
PV027394 500 ng

MYO1D Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
3-Benzyl-piperidine-1,3-dicarboxylic acid 1-tert-butyl ester
sc-266477 10 mg

3-Benzyl-piperidine-1,3-dicarboxylic acid 1-tert-butyl ester

Sign In for Pricing
View Details
VCY Double Nickase Plasmid (h2)
sc-418471-NIC-2 20 µg

VCY Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
WM-101-PK Adhesive-backed Markers
111759 625 Pack (25 Label (s) x 25 Card)

WM-101-PK Adhesive-backed Markers

Sign In for Pricing
View Details
ARHGEF37 Recombinant Protein (Human)
RP047275 100 µg

ARHGEF37 Recombinant Protein (Human)

Sign In for Pricing
View Details
Anti-CITED2 Rabbit Monoclonal Antibody
MBS179919-01 0.03 mL

Anti-CITED2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details