Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gossypium hirsutum Transcription factor bHLH84-like (LOC107908183)

This Recombinant Gossypium hirsutum transcription factor bHLH84-like (LOC107908183) spans the amino acid sequence from region 1-272aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A1U8JKW4

Expression Region

1-272aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDSMGTLLEGDWSCFSGMYTTEQEADFMAQLLSNCPQLPDIDMSNYLSDSNPVFVTNNSPISMDFCMEDGTNTSFFLVEPDDCLNPEMGKDGNVEKEPKPEPEKKSSNKRSRNSGDVHVQKTKRNGRSKKNQTIAANDDEDGNGGLNGQSWASCSSEDDSNGGANSGSKGEATLNLNGKTRASRGAATDPQSLYARKRRERINERLRILQNLVPNGTKVDISTMLEEAVQYVKFLQLQIKLLSSDDLWMYAPIAYNGMDIGIDLKVGTAKRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elongation Factor 1A2 Recombinant Rabbit mAb
BS45103-01 50 µL

Elongation Factor 1A2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Elongation Factor 1A2 Recombinant Rabbit mAb
BS45103-02 100 µL

Elongation Factor 1A2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
KBTBD5 Antibody
GWB-MN256D 50 µg

KBTBD5 Antibody

Sign In for Pricing
View Details
Canine BRCA1 associated protein (BRAP) ELISA Kit
GTR10330452 96 Well

Canine BRCA1 associated protein (BRAP) ELISA Kit

Sign In for Pricing
View Details
RGD1566036 ORF Vector (Rat) (pORF)
39429016 1.0 µg DNA

RGD1566036 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
POLR2F Rabbit pAb
E45R24336N-100 100 µL

POLR2F Rabbit pAb

Sign In for Pricing
View Details