Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Placenta growth factor (PGF) (Active)

This Recombinant Human Placenta growth factor (PGF), partial spans the amino acid sequence from region 19-170aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Placenta growth factor; PlGF; PGF; PGFL, PLGF

UniProt

P49763

Expression Region

19-170aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human FLT1 protein at 2 μg/mL can bind Human PGF protein. The EC50 is 10.72-15.25 ng/mL.

Form

Lyophilized powder

Molecular Weight

45.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Edwardsiella tarda (E. tarda) (MaxLight 650) discontinued
E2210-70-ML650 100 µL

Edwardsiella tarda (E. tarda) (MaxLight 650) discontinued

Sign In for Pricing
View Details
E2A (G-2) PE
sc-133075 PE 200 µg/mL

E2A (G-2) PE

Sign In for Pricing
View Details
PIK3C3/VPS34 Rabbit mAb
E45R12653N-100 100 µL

PIK3C3/VPS34 Rabbit mAb

Sign In for Pricing
View Details
Human SCAF1 Pre-designed siRNA Set B
SI014315B 1 Each

Human SCAF1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
FASTKD1 Antibody
A13758-100UG 100 µg

FASTKD1 Antibody

Sign In for Pricing
View Details
C-C chemokine receptor type 5 CCR5 Rabbit Polyclonal Antibody (Fluoro594)
orb3083992 100 µg

C-C chemokine receptor type 5 CCR5 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details