Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pleurotus ostreatus Ostreolysin (OlyA6)

This Recombinant Pleurotus ostreatus Ostreolysin (OlyA6) spans the amino acid sequence from region 2-138aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P83467

Expression Region

2-138aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Pleurotus ostreatus (Oyster mushroom) (White-rot fungus)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYAQWVIIIIHNVGSQDVKIKNLKASWGKLHADGDKDAEVSASNYEGKIVKPDEKLQINACGRSDAAEGTTGTFDLVDPADGDKQVRHFYWDCPWGSKTNTWTVSGSNTKWMIEYSGQNLDSGALGTITVDTLKKGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal IQGAP1 Antibody [Alexa Fluor 700]
NBP3-21443AF700 0.1 mL

Rabbit Polyclonal IQGAP1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
EIF3G antibody
70R-4993 100 µL

EIF3G antibody

Sign In for Pricing
View Details
Anti-Plakophilin 2/PKP2 Antibody Picoband®
PA2278 100 µg/Vial

Anti-Plakophilin 2/PKP2 Antibody Picoband®

Sign In for Pricing
View Details
Calcitonin receptor (CALCR) (NM_001742) Human Tagged Lenti ORF Clone
RC210171L3 10 µg

Calcitonin receptor (CALCR) (NM_001742) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human RPL13A Protein
E30P6079 20 µg

Recombinant Human RPL13A Protein

Sign In for Pricing
View Details
Human ZNF165 (NM_003447) AAV Particle
RC205600A1V 250 µL

Human ZNF165 (NM_003447) AAV Particle

Sign In for Pricing
View Details