Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sesamum indicum Oleosin L

This Recombinant Sesamum indicum Oleosin L spans the amino acid sequence from region 1-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Allergen Ses i 5) (Oleosin 15 kDa) (allergen Ses i 5.0101)

UniProt

Q9XHP2

Expression Region

1-145aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Sesamum indicum (Oriental sesame) (Sesamum orientale)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEHYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQFSQQPVAGSQTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VCE-?004.8
MBS5754097 Inquire

VCE-?004.8

Sign In for Pricing
View Details
CGS 21680 HCl
B1324-10 10 mg

CGS 21680 HCl

Sign In for Pricing
View Details
SNORD92 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2234807 1.0 µg DNA

SNORD92 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Lentiviral mouse Hcn2 shRNA (UAS) - Lentiviral mouse Hcn2 shRNA (UAS) (100)
GTR15171114 1 Vial

Lentiviral mouse Hcn2 shRNA (UAS) - Lentiviral mouse Hcn2 shRNA (UAS) (100)

Sign In for Pricing
View Details
MCherry Monoclonal Antibody
E55A05723 100 µg

MCherry Monoclonal Antibody

Sign In for Pricing
View Details
Hnrnpa1 (NM_010447) Mouse Recombinant Protein
E45M47310M5 20 µg

Hnrnpa1 (NM_010447) Mouse Recombinant Protein

Sign In for Pricing
View Details