Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sesamum indicum Oleosin L

This Recombinant Sesamum indicum Oleosin L spans the amino acid sequence from region 1-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Allergen Ses i 5) (Oleosin 15 kDa) (allergen Ses i 5.0101)

UniProt

Q9XHP2

Expression Region

1-145aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Sesamum indicum (Oriental sesame) (Sesamum orientale)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAEHYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQFSQQPVAGSQTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Pancreatic Lipase Antibody [DyLight 755]
NBP3-00154IR 0.1 mL

Rabbit Polyclonal Pancreatic Lipase Antibody [DyLight 755]

Sign In for Pricing
View Details
MHC Class II (monomorphic) Mouse Monoclonal Antibody [Clone ID: CVS20]
SM505F 100 µg

MHC Class II (monomorphic) Mouse Monoclonal Antibody [Clone ID: CVS20]

Sign In for Pricing
View Details
MDM2 Rabbit Polyclonal Antibody
orb669190 100 µg

MDM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SNAPC4 (Small Nuclear RNA Activating Complex, Polypeptide 4, 190kD, OTTHUMP00000022583, FLJ13451, PTFalpha, SNAP190) (PE)
207885-PE 100 µL

SNAPC4 (Small Nuclear RNA Activating Complex, Polypeptide 4, 190kD, OTTHUMP00000022583, FLJ13451, PTFalpha, SNAP190) (PE)

Sign In for Pricing
View Details
Zebrafish PGAM1a/b Rabbit Polyclonal Antibody (Fluoro488)
orb3089821 100 µg

Zebrafish PGAM1a/b Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
OR10G9 Human Gene Knockout Kit (CRISPR)
KN420119 1 Kit

OR10G9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details