Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Botulinum neurotoxin type E (botE), partial

This Recombinant Clostridium botulinum Botulinum neurotoxin type E (botE), partial spans the amino acid sequence from region 2-422aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BoNT/E; Bontoxilysin-E; LC; HC

UniProt

Q00496

Expression Region

2-422aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Clostridium botulinum

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PKINSFNYNDPVNDRTILYIKPGGCQEFYKSFNIMKNIWIIPERNVIGTTPQDFHPPTSLKNGDSSYYDPNYLQSDEEKDRFLKIVTKIFNRINNNLSGGILLEELSKANPYLGNDNTPDNQFHIGDASAVEIKFSNGSQDILLPNVIIMGAEPDLFETNSSNISLRNNYMPSNHRFGSIAIVTFSPEYSFRFNDNCMNEFIQDPALTLMHELIHSLHGLYGAKGITTKYTITQKQNPLITNIRGTNIEEFLTFGGTDLNIITSAQSNDIYTNLLADYKKIASKLSKVQVSNPLLNPYKDVFEAKYGLDKDASGIYSVNINKFNDIFKKLYSFTEFDLRTKFQVKCRQTYIGQYKYFKLSNLLNDSIYNISEGYNINNLKVNFRGQNANLNPRIITPITGRGLVKKIIRFCKNIVSVKGIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat anti Armenian Hamster IgG (H + L) (HRP)
43R-IG098HRP 1.5 mL

Goat anti Armenian Hamster IgG (H + L) (HRP)

Sign In for Pricing
View Details
SPINT2 Rabbit pAb
E45R26812N-50 50 µL

SPINT2 Rabbit pAb

Sign In for Pricing
View Details
GAPDHS Antibody Blocking Peptide
orb1513387 500 µg

GAPDHS Antibody Blocking Peptide

Sign In for Pricing
View Details
Bis (triphenylphosphine) palladium (II) dichloride
sc-252477 1 g

Bis (triphenylphosphine) palladium (II) dichloride

Sign In for Pricing
View Details
HIST2H2AA4 ORF Vector (Human) (pORF)
ORF004931 1.0 µg DNA

HIST2H2AA4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
APOA1 Recombinant Protein (Mouse)
RP116414 100 µg

APOA1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details