Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Neutrophilic granule protein (Ngp)

This Recombinant Mouse Neutrophilic granule protein (Ngp) spans the amino acid sequence from region 22-167aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NGP; Cystatin-like protein; Myeloid bactenecin protein; Myeloid secondary granule protein

UniProt

O08692

Expression Region

22-167aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRQLRYEEIVDRAIEAYNQGRQGRPLFRLLSATPPSSQNPATNIPLQFRIKETECTSTQERQPKDCDFLEDGEERNCTGKFFRRRQSTSLTLTCDRDCSREDTQETSFNDKQDVSEKEKFEDVPPHIRNIYEDAKYDIIGNILKNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 5 Recombinant Rabbit mAb
E43S49608 100 µL

Cytokeratin 5 Recombinant Rabbit mAb

Sign In for Pricing
View Details
hsa-miR-6789-5p miRNA Antagomir
MBS8318183-01 10 nmol

hsa-miR-6789-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-6789-5p miRNA Antagomir
MBS8318183-02 20 nmol

hsa-miR-6789-5p miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-6789-5p miRNA Antagomir
MBS8318183-03 5x 20 nmol

hsa-miR-6789-5p miRNA Antagomir

Sign In for Pricing
View Details
Ssbp2 3'UTR Luciferase Stable Cell Line
TU119729 1.0 mL

Ssbp2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit anti-PFl Antibody, Affinity Purified
A301-646A-T 10 µg

Rabbit anti-PFl Antibody, Affinity Purified

Sign In for Pricing
View Details