IPO9 Peptide - C-terminal region
IPO9 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Imp9
UniProt
Q96P70
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_060555.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ARQATPAEWSQDDSNDMWEDQEEEEEEEEDGLAGQLLSDILATSKYEEDY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9024157-01 500 mg
(+/-)-trans-4-(3-bromo-phenyl)-pyrrolidine-3-carboxylic acid-HCl
Sign In for Pricing
View Details MBS9024157-02 5x 500 mg
(+/-)-trans-4-(3-bromo-phenyl)-pyrrolidine-3-carboxylic acid-HCl
Sign In for Pricing
View Details GTR15386703 1 Vial
Lentiviral human OR6T1 sgRNA gene knockout kit - Lentiviral human OR6T1 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details MBS6247629-01 0.1 mL
CD43 (T Cell Marker, Leukosialin, Sialophorin, or Leukocyte Sialoglycoprotein) (AP)
Sign In for Pricing
View Details MBS6247629-02 5x 0.1 mL
CD43 (T Cell Marker, Leukosialin, Sialophorin, or Leukocyte Sialoglycoprotein) (AP)
Sign In for Pricing
View Details