Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IPO9 Peptide - C-terminal region

IPO9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Imp9

UniProt

Q96P70

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060555.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARQATPAEWSQDDSNDMWEDQEEEEEEEEDGLAGQLLSDILATSKYEEDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UPA ELISA Kit (Cattle)
OKCD04432-96W 96 Well

UPA ELISA Kit (Cattle)

Sign In for Pricing
View Details
PCNA Antibody Blocking Peptide
orb1507703 500 µg

PCNA Antibody Blocking Peptide

Sign In for Pricing
View Details
Human Thrombopoietin (Tpo) ELISA kit
E22-HC158.48 48 Tests

Human Thrombopoietin (Tpo) ELISA kit

Sign In for Pricing
View Details
CDC2 (Ab-161) Antibody
MBS857603-01 0.05 mg

CDC2 (Ab-161) Antibody

Sign In for Pricing
View Details
CDC2 (Ab-161) Antibody
MBS857603-02 0.1 mg

CDC2 (Ab-161) Antibody

Sign In for Pricing
View Details
CDC2 (Ab-161) Antibody
MBS857603-03 0.1 mL (AF750)

CDC2 (Ab-161) Antibody

Sign In for Pricing
View Details