SKP2 Peptide - middle region
SKP2 Peptide - middle region
Product Specifications
Product Name Alternative
P45, FBL1, FLB1, FBXL1
UniProt
Q13309
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SKP2 Rabbit Polyclonal Antibody (orb588169) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_005974
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M3545-61 50 mg
4-Methylumbelliferyl 2-Trifluoroacetyl-3,4,6-O-triacetyl-2-deoxy-b-D-glucopyranoside
Sign In for Pricing
View Details 
MBS2509292-01 24 Tests
Porcine TPS (Tissue Polypeptide Specific Antigen) ELISA Kit
Sign In for Pricing
View Details MBS2509292-02 48 Tests
Porcine TPS (Tissue Polypeptide Specific Antigen) ELISA Kit
Sign In for Pricing
View Details