Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SKP2 Peptide - middle region

SKP2 Peptide - middle region

Product Specifications

Product Name Alternative

P45, FBL1, FLB1, FBXL1

UniProt

Q13309

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SKP2 Rabbit Polyclonal Antibody (orb588169) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005974

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHB, NT (SH2 Domain-containing Adapter Protein B) (MaxLight 750)
MBS6499282-01 0.1 mL

SHB, NT (SH2 Domain-containing Adapter Protein B) (MaxLight 750)

Sign In for Pricing
View Details
SHB, NT (SH2 Domain-containing Adapter Protein B) (MaxLight 750)
MBS6499282-02 5x 0.1 mL

SHB, NT (SH2 Domain-containing Adapter Protein B) (MaxLight 750)

Sign In for Pricing
View Details
NOD2 (Nucleotide-binding Oligomerization Domain-containing Protein 2, Caspase Recruitment Domain-containing Protein 15, Inflammatory Bowel Disease Protein 1, CARD15, IBD1, ACUG, BLAU, CLR16.3, PSORAS1) (HRP)
MBS6387231-01 0.1 mL

NOD2 (Nucleotide-binding Oligomerization Domain-containing Protein 2, Caspase Recruitment Domain-containing Protein 15, Inflammatory Bowel Disease Protein 1, CARD15, IBD1, ACUG, BLAU, CLR16.3, PSORAS1) (HRP)

Sign In for Pricing
View Details
NOD2 (Nucleotide-binding Oligomerization Domain-containing Protein 2, Caspase Recruitment Domain-containing Protein 15, Inflammatory Bowel Disease Protein 1, CARD15, IBD1, ACUG, BLAU, CLR16.3, PSORAS1) (HRP)
MBS6387231-02 5x 0.1 mL

NOD2 (Nucleotide-binding Oligomerization Domain-containing Protein 2, Caspase Recruitment Domain-containing Protein 15, Inflammatory Bowel Disease Protein 1, CARD15, IBD1, ACUG, BLAU, CLR16.3, PSORAS1) (HRP)

Sign In for Pricing
View Details
Porcine Chemokine CCL20 Recombinant
IPCCCL20R25UG 1 Each

Porcine Chemokine CCL20 Recombinant

Sign In for Pricing
View Details
Anti-Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1H4]
M02282 100 µL

Anti-Pyruvate Kinase (PKLR) Mouse Monoclonal Antibody [Clone ID: OTI1H4]

Sign In for Pricing
View Details