Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSPAN9 Peptide - C-terminal region

TSPAN9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NET5, NET-5, PP1057

UniProt

O75954

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001161792.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CYEKVKMWFDDNKHVLGTVGMCILIMQILGMAFSMTLFQHIHRTGKKYDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 Tumor Suppressor Protein (rBP53-12), CF405S conjugate, 0.1mg/mL
BNC042094-100 1x 100 µL

P53 Tumor Suppressor Protein (rBP53-12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CEP44 Antibody
KC-21339-01 50 μL

CEP44 Antibody

Sign In for Pricing
View Details
CEP44 Antibody
KC-21339-02 100 µL

CEP44 Antibody

Sign In for Pricing
View Details
CEP44 Antibody
KC-21339-03 1 mL

CEP44 Antibody

Sign In for Pricing
View Details
G protein alpha 16 (GNA15) Human Gene Knockout Kit (CRISPR)
KN402243 1 Kit

G protein alpha 16 (GNA15) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FOLR1 Antibody
8C15761-AAT 50 µg

FOLR1 Antibody

Sign In for Pricing
View Details